Analytical Data
-
Gene name
Tb4Y
- Application
-
Alternative Names
Tb4Y；TB4Y；Thymosin beta-4. Y-chromosomal
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14604
-
Expression Region
1-44aa
-
AA Sequence
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tb4Y recombinant protein has garnered significant attention in recent years due to its potential applications in biotechnology and medicine. This protein, derived from the *Trypanosoma brucei* species, responsible for African sleeping sickness, plays a crucial role in the organism's survival and pathogenicity. Researchers have been particularly interested in Tb4Y for its unique structural features and functional properties that may serve as targets for drug development. The concern over traditional treatments, which often suffer from toxicity and resistance issues, has propelled the exploration of novel therapeutic strategies, with Tb4Y emerging as a promising candidate. Additionally, the study of this protein offers insights into trypanosome biology, laying the groundwork for understanding host-parasite interactions. Given the global health implications associated with trypanosomiasis, investigating Tb4Y may not only contribute to the development of more effective therapeutics but also enhance our understanding of the molecular mechanisms underlying parasitic infections. Researchers continue to explore various expression systems and purification methods for Tb4Y to characterize its biological functions and potential applications in vaccine development and diagnostics. This growing body of research underscores the importance of Tb4Y in addressing major challenges in infectious disease management and highlights the interdisciplinary nature of modern biomedical research, merging basic science with applied health solutions.
