Analytical Data
-
Gene name
DNASE2B
- Application
-
Alternative Names
DNASE2B; DLADDeoxyribonuclease-2-beta; EC 3.1.22.1; DNase II-like acid DNase; DNase2-like acid DNase; Deoxyribonuclease II beta; DNase II beta; Endonuclease DLAD
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WZ79
-
Expression Region
1-153aa
-
AA Sequence
MPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
-
Molecular Weight
44.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNASE2B is a member of the DNase family, primarily involved in the hydrolysis of DNA, which plays a crucial role in various biological processes, including apoptosis, DNA turnover, and the immune response. Recent studies have highlighted its importance in maintaining cellular homeostasis and the body's defense mechanisms against pathogens by clearing extracellular DNA, which could otherwise trigger inflammation or autoimmune responses. Deficiencies or mutations in DNASE2B have been linked to certain genetic disorders, underlining its significance in human health. As a result, research into DNASE2B recombinant proteins has gained momentum, focusing on their structural properties, enzymatic activity, and potential therapeutic applications. Understanding the functional mechanisms of DNASE2B can lead to novel strategies for treating diseases associated with DNA metabolism dysregulation, such as systemic lupus erythematosus and other inflammatory conditions. Moreover, the development of recombinant DNASE2B proteins offers promising prospects for enhancing therapeutic interventions, including DNA-based vaccines and gene therapy, thereby contributing to advances in molecular medicine and biotechnology.
