Analytical Data
-
Gene name
DMRTB1
- Application
-
Alternative Names
DMRT B 1; DMRT like family B with proline rich C terminal 1; DMRTB_HUMAN; Dmrtb1; Doublesex- and mab-3-related transcription factor B1; FLJ32711; FLJ40434 ; HGNC:13913
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MA1
-
Expression Region
1-189aa
-
AA Sequence
MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD
-
Molecular Weight
46.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DMRTB1 (Doublesex and Mab-3 Related Transcription Factor B1) is a member of the DMRT (Doublesex MAB-3 Related Transcription factor) gene family, known for its critical role in the regulation of sexual differentiation and development in various organisms. Research into DMRTB1 has gained significance due to its involvement in the mechanisms underlying gonadal development and function. In recent years, studies have demonstrated that DMRTB1 is not only essential for male sex determination in certain species but also plays a role in the maintenance of male reproductive structures. This has fueled interest in understanding its molecular pathways and interactions, particularly in the context of reproductive health and disorders. Moreover, DMRTB1 has been implicated in the evolution of sexual dimorphism, making it a key target for evolutionary biology research. Advances in recombinant protein technology have enabled the production of DMRTB1 in a controlled laboratory setting, allowing for detailed biochemical and biophysical characterization. These studies aim to elucidate the function of DMRTB1 at the molecular level, providing insights into its role in gene regulation and potential applications in reproductive biotechnology and genetic engineering. As we continue to unravel the complexities of DMRTB1, there is hope that this research will not only enhance our understanding of sexual development but also contribute to addressing issues related to infertility and genetic conditions linked to sex differentiation.











