Analytical Data
-
Gene name
KNT1
- Application
-
Alternative Names
KNT1；Kinectin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A1Z4NLL6
-
Expression Region
1-88aa
-
AA Sequence
MFLEPKPTQQIDRLNLADQIIQRILTLKEKQVIAIGLYGSLARGTDQLYSDIEIKCILNTEEEDYSWEWIEDGCKIEINFESEDVILN
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KNT1, a member of the potassium channel family, is of considerable interest in biomedical research due to its potential roles in various physiological and pathological processes. Initially identified as a key player in cellular signal transduction, KNT1 is believed to influence neuronal excitability, muscle contraction, and cardiac function. Recent studies have highlighted its involvement in conditions such as arrhythmias and neurodegenerative diseases, underscoring the necessity to understand its functional mechanisms better. Research on recombinant KNT1 protein has emerged to investigate its structure-function relationships, interactions with other proteins, and regulatory pathways. Additionally, characterization of KNT1 through recombinant technology allows for high-yield production and detailed biochemical analysis, providing insights into its critical role in cellular physiology. This foundational knowledge is essential for exploring therapeutic interventions that could modulate KNT1 activity, potentially offering new strategies for treating related disorders. As research progresses, the elucidation of KNT1’s functional properties through recombinant protein studies is expected to pave the way for innovative approaches in pharmacology and regenerative medicine.
