Analytical Data
-
Gene name
TYROBP
- Application
-
Alternative Names
TYROBP；DAP12；KARAP；TYRO Protein tyrosine kinase-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43914
-
Expression Region
1-113aa
-
AA Sequence
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGD LVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSD VYSDLNTQRPYYK
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TYROBP, or Tyrosine Kinase Binding Protein, is a crucial adaptor protein involved in various cellular processes, including immune response and cell signaling. It primarily interacts with receptors of the immune system, such as activating Fc receptors and various pattern recognition receptors. Researchers have shown that TYROBP plays a significant role in mediating the activation of myeloid cells, which include monocytes and macrophages, leading to enhanced responses to pathogens. Mutations or dysregulation of TYROBP have been linked to several diseases, including autoimmune disorders and certain types of cancer, making it a target of interest for therapeutic interventions. The recombinant protein of TYROBP is utilized in various experimental settings to elucidate its function and signaling pathways. Studying TYROBP at a molecular level helps in understanding how it regulates immune functions and could provide insights into developing novel treatments for diseases characterized by immune dysregulation. Given the increasing relevance of innate immunity in health and disease, the research on TYROBP recombinant protein continues to be pivotal in advancing our comprehension of immunological mechanisms and potential therapeutic applications.
