Analytical Data
-
Gene name
TLR7
- Application
-
Alternative Names
TLR7；Toll-like receptor 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYK1
-
Expression Region
27-126aa
-
AA Sequence
ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINH IPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptor 7 (TLR7) is a key component of the innate immune system, primarily involved in recognizing single-stranded RNA from viruses and initiating immune responses. It plays a crucial role in detecting viral infections and activating dendritic cells, which further stimulate adaptive immunity. Research on TLR7 has garnered significant attention due to its potential implications in vaccine development and therapeutic strategies against viral infections and autoimmune diseases. TLR7 is expressed in various immune cells, and its activation leads to the production of pro-inflammatory cytokines and type I interferons, essential for antiviral defense. Moreover, TLR7's relevance has been underscored in studies relating to the pathogenesis of systemic lupus erythematosus (SLE), where its overactivation is linked to autoimmunity. Investigating TLR7 in the context of recombinant protein studies allows for a deeper understanding of its structure-function relationship, enabling the design of novel immunotherapeutics that can modulate TLR7 activity for enhanced immune responses. As researchers continue to explore TLR7's mechanisms and interactions, the development of TLR7-based vaccines and adjuvants presents a promising avenue to improve immune activation and combat various infectious and autoimmune disorders. The recombinant expression of TLR7 in appropriate models further facilitates the study of its signaling pathways and interaction with ligands, providing insights that could lead to innovative treatments and preventive measures in immunology.
