Cat: PA2000-7140

Recombinant Human DLX1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DLX1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DII B; Distal less homeo box 1; Distal less homeobox 1; Distal-less homeobox gene 1a; Dlx 1; Dlx; Dlx1; Dlx1 distal-less homeobox 1; DLX1_HUMAN; Homeo box protein DLX1; Homeobox protein DLX 1; Homeobox protein DLX-1; Homeobox protein Dlx1a

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56177

  • Expression Region

    1-255aa

  • AA Sequence

    MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM

  • Molecular Weight

    53.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DLX1 (distal-less homeobox 1) is a member of the homeobox gene family, crucial for various developmental processes, particularly in the formation of the central nervous system and craniofacial structures. It plays a significant role in regulating neuronal differentiation and patterning during embryogenesis. Dysregulation of DLX1 has been associated with several neurodevelopmental disorders and conditions such as schizophrenia and autism spectrum disorders, highlighting its potential as a therapeutic target. The study of DLX1 recombinant proteins is essential for understanding its functional mechanisms, interactions with other proteins, and role in gene regulation. By producing DLX1 as a recombinant protein, researchers can investigate its biochemical properties, delineate its signaling pathways, and evaluate its influence on gene expression in various cellular contexts. This research may also facilitate the development of novel therapeutic strategies aimed at correcting DLX1-related pathologies, offering insights into the broader implications of homebox genes in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US