Analytical Data
-
Gene name
DLX1
- Application
-
Alternative Names
DII B; Distal less homeo box 1; Distal less homeobox 1; Distal-less homeobox gene 1a; Dlx 1; Dlx; Dlx1; Dlx1 distal-less homeobox 1; DLX1_HUMAN; Homeo box protein DLX1; Homeobox protein DLX 1; Homeobox protein DLX-1; Homeobox protein Dlx1a
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56177
-
Expression Region
1-255aa
-
AA Sequence
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
-
Molecular Weight
53.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLX1 (distal-less homeobox 1) is a member of the homeobox gene family, crucial for various developmental processes, particularly in the formation of the central nervous system and craniofacial structures. It plays a significant role in regulating neuronal differentiation and patterning during embryogenesis. Dysregulation of DLX1 has been associated with several neurodevelopmental disorders and conditions such as schizophrenia and autism spectrum disorders, highlighting its potential as a therapeutic target. The study of DLX1 recombinant proteins is essential for understanding its functional mechanisms, interactions with other proteins, and role in gene regulation. By producing DLX1 as a recombinant protein, researchers can investigate its biochemical properties, delineate its signaling pathways, and evaluate its influence on gene expression in various cellular contexts. This research may also facilitate the development of novel therapeutic strategies aimed at correcting DLX1-related pathologies, offering insights into the broader implications of homebox genes in health and disease.











