Analytical Data
-
Gene name
ACSS3
- Application
-
Alternative Names
ACSS3；Acyl-CoA synthetase short-chain family member 3. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6R3
-
Expression Region
30-686aa
-
AA Sequence
AGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA
-
Molecular Weight
77.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACSS3 (Acetyl-CoA synthetase 3) is an enzyme that plays a critical role in cellular metabolism by catalyzing the conversion of acetate into acetyl-CoA, a central metabolite involved in various biosynthetic pathways and energy production. Recent studies have highlighted the importance of ACSS3 in regulating metabolic processes, particularly in conditions such as obesity, cancer, and neurodegenerative diseases. The reprogramming of acetate metabolism has garnered significant attention, as aberrant acetyl-CoA levels can influence histone acetylation and gene expression, thereby altering cellular signaling and functionality. Research into ACSS3 has progressed in understanding its structure-function relationship, regulatory mechanisms, and potential therapeutic implications. Developing ACSS3-targeted therapies could offer novel strategies for manipulating metabolic pathways in disease contexts. Scientists are investigating the enzyme’s role in metabolic adaptation under stress and its interaction with other cellular pathways, further elucidating its significance in health and disease. This body of work aims to establish ACSS3 not only as a metabolic enzyme but also as a possible biomarker and therapeutic target for conditions characterized by metabolic dysregulation.
