Analytical Data
-
Gene name
NOTCH2
- Application
-
Alternative Names
NOTCH2；KIAA1024L；Major intrinsically disordered NOTCH2-binding receptor 1-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04721
-
Expression Region
27-136aa
-
AA Sequence
QCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNG GTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSR DTYECTCQVG
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NOTCH signaling pathway plays a crucial role in various biological processes, including cell differentiation, proliferation, and apoptosis. Dysregulation of NOTCH signaling has been implicated in numerous diseases, particularly cancer. Among the NOTCH receptors, NOTCH2 has garnered significant attention due to its unique functions in development and its role in hematopoiesis and solid tumors. NOTCH2 undergoes complex post-translational modifications and interacts with several downstream effectors, influencing a variety of cellular responses. The study of NOTCH2 recombinant proteins has become vital for understanding the mechanistic insights of NOTCH signaling, which can aid in identifying therapeutic targets for cancers characterized by aberrant NOTCH activity. Researchers utilize recombinant NOTCH2 proteins to explore its structural properties, binding dynamics, and functional roles within the pathway, facilitating the development of small molecule inhibitors or monoclonal antibodies aimed at modulating NOTCH2 activity in pathological contexts. Additionally, elucidating the precise mechanisms through which NOTCH2 operates at the molecular level can lead to improved clinical strategies, advancing personalized medicine approaches for patients whose malignancies are driven by NOTCH signaling aberrations. Overall, the investigation of NOTCH2 recombinant proteins is integral to expanding our understanding of both normal physiological processes and disease-associated disruptions.
