Analytical Data
-
Gene name
NDUFA12
- Application
-
Alternative Names
NDUFA12；NDUFA12L；NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UI09
-
Expression Region
1-145aa
-
AA Sequence
MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFA12, or NADH:ubiquinone oxidoreductase iron-sulfur protein 12, is a crucial component of the mitochondrial respiratory chain, specifically part of Complex I, which plays a vital role in ATP production and cellular energy metabolism. Research on NDUFA12 has gained importance due to its involvement in various mitochondrial dysfunctions and metabolic disorders. Mutations or alterations in the expression of NDUFA12 are linked to neurodegenerative diseases, oxidative stress, and conditions like Leigh syndrome, highlighting its significance in human health. Furthermore, the study of NDUFA12 as a recombined protein has opened avenues for understanding the molecular mechanisms underlying mitochondrial diseases and developing potential therapeutic strategies. Through the expression and purification of recombinant NDUFA12, researchers aim to elucidate its structure, function, and interaction with other subunits of the respiratory chain. This research not only aids in deciphering the complexities of mitochondrial bioenergetics but also paves the way for identifying biomarkers for mitochondrial disorders and exploring novel interventions to restore normal mitochondrial function. Overall, the investigation of NDUFA12 remains a pivotal area in the quest to unravel the intricacies of energy metabolism and its implications in health and disease.
