Analytical Data
-
Gene name
PAK1
- Application
-
Alternative Names
PAK1；Serine/threonine-Protein kinase PAK 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13153
-
Expression Region
1-545aa
-
AA Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
-
Molecular Weight
76.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAK1 (p21-activated kinase 1) is a serine/threonine kinase that plays a crucial role in various cellular processes, including cytoskeletal dynamics, cell motility, and signal transduction. It is part of the p21-activated kinase family, which is activated by the Rho family of GTPases. Dysregulation of PAK1 has been implicated in several diseases, particularly cancer, where it promotes tumorigenesis, invasion, and metastasis through pathways that alter gene expression and cellular behavior. The study of recombinant PAK1 protein has gained significant attention as it allows researchers to explore its biochemical properties, regulation, and functional significance in cellular contexts. By producing PAK1 as a recombinant protein, scientists can investigate its enzymatic activity, interactions with other proteins, and its role in signaling pathways in detail. Understanding PAK1's mechanisms of action may reveal potential therapeutic targets for treating cancers and other disorders associated with its dysfunction. Furthermore, recombinant PAK1 can be utilized in drug screening assays and in the development of PAK1-specific inhibitors that could pave the way for novel treatment strategies. Overall, the research on recombinant PAK1 protein is pivotal in elucidating its functions in health and disease and could lead to advancements in targeted therapies.
