Analytical Data
-
Gene name
SAP30BP
- Application
-
Alternative Names
SAP30BP;HCNGP;HTRG;HTRP;SAP30-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHR5
-
Expression Region
91-308aa
-
AA Sequence
TEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
-
Molecular Weight
28.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAP30BP (SAP30-binding protein) is an essential component in the regulation of various cellular processes, including transcriptional regulation and chromatin remodeling. Research on SAP30BP has gained significance due to its association with the Sin3 co-repressor complex, which is known to play a critical role in gene expression and cellular differentiation. Furthermore, SAP30BP has been implicated in the development of various diseases, including cancer, where altered expression of co-regulators can lead to dysregulated gene activity. Understanding the structural and functional properties of SAP30BP is crucial for unraveling its role in these biological processes. Studies have demonstrated that SAP30BP interacts with multiple transcription factors and co-regulators, thus influencing the assembly and activity of transcriptional complexes. As a result, it is a target of interest for potential therapeutic interventions aimed at restoring normal gene expression patterns. Recent advancements in structural biology and biochemistry techniques, such as X-ray crystallography and cryo-electron microscopy, have enabled researchers to elucidate the detailed mechanisms by which SAP30BP exerts its function, paving the way for future studies that may reveal novel strategies for targeting the pathways involved in disease progression. Overall, the continued exploration of SAP30BP and its associated molecular partners is critical for better understanding gene regulation and finding new avenues for treatment in conditions where these processes are disrupted.











