Analytical Data
-
Gene name
SPG11
- Application
-
Alternative Names
Colorectal carcinoma-associated protein;Spastic paraplegia 11 protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JI7
-
Expression Region
2095-2387 aa
-
AA Sequence
LVGMKLLDKISSVPHGELSCTTELLILAHHCFTLTCHMEGIIRVLQAAHMLTDNHLAPSEEYGLVVRLLTGIGRYNEMTYIFDLLHKKHYFEVLMRKKLDPSGTLKTALLDYIKRCRPGDSEKHNMIALCFSMCREIGENHEAAARIQLKLIESQPWEDSLKDGHQLKQLLLKALTLMLDAAESYAKDSCVRQAQHCQRLTKLITLQIHFLNTGQNTMLINLGRHKLMDCILALPRFYQASIVAEAYDFVPDWAEILYQQVILKGDFNYLEEFKQQRLLKSSIFEEISKKYKQ
-
Molecular Weight
40.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPG11 (Spastic Paraplegia 11) is a gene associated with a hereditary form of spastic paraplegia, characterized by progressive weakness and stiffness of the legs. Mutations in the SPG11 gene lead to a spectrum of neurological symptoms, including cognitive impairment and ataxia, making it one of the most common causes of autosomal recessive spastic paraplegia. Research on SPG11 recombinant proteins is critical for understanding the biological functions and pathological mechanisms of the gene, as well as for developing potential therapeutic strategies. Recombinant proteins provide a valuable tool for studying protein interactions, localization, and their role in cellular pathways. Recent studies have focused on characterizing the biochemical properties of SPG11, exploring its interactions with other cellular components, and investigating how mutations affect protein stability and function. These insights are crucial not only for elucidating the disease mechanisms but also for paving the way toward targeted interventions that could mitigate the effects of SPG11-related disorders. Furthermore, the generation of SPG11 recombinant proteins has opened new avenues for developing cellular and animal models to study the disease, ultimately contributing to a deeper understanding of spastic paraplegia and its treatment.
