Analytical Data
-
Gene name
PUMA
- Application
-
Alternative Names
PUMA；PUMA；Bcl-2-binding component 3. isoforms 1/2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXH1
-
Expression Region
1-193aa
-
AA Sequence
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PUMA (p53 upregulated modulator of apoptosis) is a pro-apoptotic protein that plays a crucial role in the intrinsic pathway of apoptosis, particularly in response to cellular stress and damage. It is regulated by the tumor suppressor protein p53 and acts as a critical mediator in the signaling pathways that lead to programmed cell death. The study of PUMA and its recombinant forms has garnered significant interest in the fields of cancer research and therapeutic development, as its activation can induce apoptosis in cancer cells, thereby potentially enhancing the efficacy of anti-cancer therapies. The ability to produce and manipulate PUMA as a recombinant protein enables researchers to explore its structural properties, interaction with other apoptotic factors, and therapeutic applications. Understanding the mechanism of PUMA can lead to novel strategies for overcoming resistance to apoptosis in tumors, making PUMA a focal point for investigations aimed at developing targeted cancer treatments. As the understanding of its functional dynamics progresses, the potential for PUMA-based therapies in combination with existing treatment modalities continues to expand, offering promising avenues for improving patient outcomes in various malignancies.
