Analytical Data
-
Gene name
SPATA9
- Application
-
Alternative Names
SPATA9; Spermatogenesis-associated protein 9; Testis development protein NYD-SP16
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BWV2
-
Expression Region
1-254 aa
-
AA Sequence
MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI
-
Molecular Weight
55.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPATA9 (Spermatogenesis Associated 9) is a gene that encodes a protein implicated in male fertility and spermatogenesis. Research on SPATA9 has gained traction due to its essential role in the reproductive system, where it is believed to participate in the process of sperm development and maturation. Abnormalities in SPATA9 expression or function have been associated with various male infertility issues, making it a focal point for studies aimed at understanding the molecular mechanisms underlying sperm production. Additionally, SPATA9 has been studied in the context of cellular stress responses and apoptosis, revealing its potential involvement in germ cell survival. Recent advancements in recombinant protein technology have enabled the production of SPATA9 in vitro, allowing for detailed structural and functional analyses, as well as the exploration of its interactions with other proteins involved in spermatogenesis. These studies are critical for elucidating the biological significance of SPATA9 and its potential as a therapeutic target for male infertility treatments. Understanding the role of SPATA9 at the molecular level could provide insights into developing novel strategies to enhance sperm quality and improve fertility outcomes in affected individuals. Overall, the ongoing research into SPATA9 recombinant protein promises to contribute significantly to reproductive biology and therapeutic innovations in tackling male infertility.
