Cat: PA1000-7832

Recombinant Human ISL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ISL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ISL1;Insulin gene enhancer Protein ISL-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P61371

  • Expression Region

    2-349aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHENLYFQGGEFGDMGDPPKKKRLISLCVGCGN QIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYI RLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFAL REDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRP HVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSP RVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPER HDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSN STGSEVASMSSQLPDTPNSMVASPIEAESGGGGSPGRRRRRRRRRRR

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ISL1 (Islet-1) is a member of the LIM-homeodomain transcription factor family, playing a pivotal role in the development and function of various tissues, particularly in the heart and pancreas. Research into ISL1 has garnered significant interest due to its essential contribution to the differentiation of cardiac progenitor cells and the formation of insulin-producing β-cells in the pancreas. Abnormal expression of ISL1 has been linked to congenital heart defects and diabetes, making it a potential therapeutic target. The study of recombinant ISL1 proteins has emerged as a vital tool in understanding its functional mechanisms and interactions in cellular contexts. By utilizing recombinant DNA technology, researchers can produce large quantities of ISL1 protein for biochemical assays, structural studies, and functional analyses. This has facilitated the exploration of ISL1's role in gene regulation, its interaction with other transcription factors, and its influence on cellular fate decisions. Additionally, recombinant ISL1 proteins are instrumental in investigating the pathways involved in cardiovascular and metabolic diseases, potentially leading to novel therapeutic strategies. Overall, the study of ISL1 recombinant proteins represents a promising avenue for advancing our comprehension of developmental biology and its implications in human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US