Analytical Data
-
Gene name
SOS1
- Application
-
Alternative Names
Son of sevenless homolog 1. SOS-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07889
-
Expression Region
1-313-420 aa
-
AA Sequence
SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
-
Molecular Weight
37.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SOS1 (Son of Sevenless 1) is a crucial protein involved in the Ras signaling pathway, which plays a significant role in cell proliferation, differentiation, and survival. The protein functions as a guanine nucleotide exchange factor (GEF) that specifically activates Ras proteins, thereby influencing various cellular processes and signaling cascades. Mutations or dysregulation of SOS1 have been associated with several types of cancers and developmental disorders, making it a potential therapeutic target. Additionally, SOS1 is implicated in conditions like Noonan syndrome and cardio-facio-cutaneous syndrome, where its aberrant signaling contributes to pathophysiology. Given its central role in mediating Ras activation, the study of SOS1 and the development of recombinant SOS1 proteins have gained considerable interest in both basic research and clinical applications. Researchers aim to elucidate the structural and functional mechanisms of SOS1, to devise strategies for modulating its activity in disease contexts, and to explore its interactions with other cellular components. The development of SOS1 recombinant proteins facilitates high-throughput screening for small-molecule inhibitors or activators, providing insights into therapeutic possibilities for conditions where Ras signaling is misregulated. Therefore, ongoing research into SOS1 recombinant proteins holds promise for enhancing our understanding of cancer biology and other related disorders, ultimately aiming to advance targeted therapeutic approaches.
