Analytical Data
-
Gene name
PDP2
- Application
-
Alternative Names
PDP2;KIAA1348;[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P2J9
-
Expression Region
67-529aa
-
AA Sequence
STEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
-
Molecular Weight
56.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDP2 (Pseudomonas syringae Pyoverdine Receptor Protein 2) is an important protein involved in the transport and uptake of siderophores, specifically pyoverdines, which are iron-chelating compounds produced by various bacterial species. In the context of microbial ecology and plant-pathogen interactions, understanding the function and structure of PDP2 can provide insights into how bacteria acquire essential nutrients in iron-limited environments, such as in plant tissues. The study of PDP2 is particularly relevant given the increasing importance of plant-associated microbes in agriculture, has implications for crop health and disease resistance. By investigating the biochemical properties and genetic regulation of PDP2, researchers aim to elucidate its role in bacterial virulence and competitiveness, especially in phytopathogenic strains. This research not only enhances our understanding of microbial nutrient acquisition strategies but also opens avenues for biotechnological applications, including the development of biocontrol agents and the design of novel strategies to enhance plant resistance to pathogens. Through techniques like recombinant protein expression and structure-function analyses, scientists can better characterize PDP2, paving the way for future studies aimed at harnessing its mechanisms for environmental and agricultural benefits.











