Analytical Data
-
Gene name
DDX49
- Application
-
Alternative Names
Probable ATP-dependent RNA helicase DDX49. EC:3.6.4.13. DEAD box protein 49
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6V7
-
Expression Region
1-483aa
-
AA Sequence
MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQGLV
-
Molecular Weight
80.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX49, a member of the DEAD-box family of RNA helicases, plays a crucial role in various cellular processes, including RNA metabolism, translation regulation, and stress response. The DEAD-box proteins, characterized by their conserved motifs, are known to unwind RNA structures, facilitating the recruitment of ribonucleoprotein complexes and promoting RNA processing events such as splicing and translation initiation. Research into DDX49 has gained momentum due to its potential implications in cellular differentiation and development, as well as its involvement in various diseases, including cancer. Aberrant expression or dysfunction of DDX49 has been linked to disrupted cellular homeostasis, impacting RNA regulation pathways. Moreover, understanding the structural and functional aspects of DDX49 can provide insights into its mechanisms of action in RNA processing and metabolic regulation. Furthermore, the development of DDX49 recombinant proteins may offer valuable tools for investigating its biological functions and interactions, paving the way for therapeutic applications targeting DDX49-related pathways. As such, ongoing research aims to elucidate the precise roles of DDX49 in cellular contexts, ultimately contributing to our understanding of its broader significance in health and disease.
