Analytical Data
-
Gene name
QPCTL
- Application
-
Alternative Names
QPCTL；Glutaminyl-peptide cyclotransferase-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXS2
-
Expression Region
212-382aa
-
AA Sequence
AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
QPCTL (quinoprotein cysteine transaminase-like) is a protein that has garnered attention due to its involvement in various biochemical pathways and potential implications in disease. Initially discovered as a member of the aminotransferase family, QPCTL is believed to play a crucial role in the metabolism of amino acids and the regulation of redox homeostasis in cells. Its unique structure, characterized by the presence of a quinone cofactor, distinguishes it from other similar enzymes, providing insights into its function and catalytic mechanisms. Recent studies have highlighted its significance in cellular stress responses, suggesting a potential role in protecting against oxidative damage and contributing to cellular antioxidant defense systems. Furthermore, alterations in QPCTL expression have been linked to various pathological conditions, including neurodegenerative diseases and cancers, which underscores the importance of understanding its function and regulation. The recombinant expression of QPCTL allows for the study of its enzymatic properties and interactions in controlled experimental settings, paving the way for future therapeutic applications. Investigating the structure-function relationship of QPCTL through techniques such as X-ray crystallography and site-directed mutagenesis can provide invaluable information for drug design and biomolecular engineering. By unraveling the mechanisms underlying QPCTL's activity and its role in cellular processes, researchers hope to uncover novel strategies for disease intervention and therapeutic development. The ongoing research surrounding QPCTL reaffirms its potential as a significant target for understanding metabolic diseases and developing innovative treatments.
