Analytical Data
-
Gene name
JAG2
- Application
-
Alternative Names
JAG2；Protein jagged-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y219
-
Expression Region
121-210aa
-
AA Sequence
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAG MINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JAG2 (Jagged 2) is a ligand of the Notch signaling pathway, playing a critical role in cell-to-cell communication during development and in various physiological processes. As a key player in regulating cell fate, proliferation, and differentiation, JAG2 has garnered significant interest in the fields of developmental biology and cancer research. Abnormalities in the Notch signaling pathway, which JAG2 is part of, have been implicated in numerous pathologies including tumors, cardiovascular diseases, and neurodegenerative disorders. The study of JAG2 recombinant proteins is crucial for understanding its molecular mechanisms and functional roles. By producing JAG2 as a recombinant protein, researchers can investigate its binding affinity to Notch receptors, explore its structural properties, and evaluate its interactions with other signaling molecules. This research contributes to the broader understanding of Notch-mediated processes and may lead to the identification of novel therapeutic targets for diseases associated with dysregulated Notch signaling. Moreover, the ability to produce JAG2 in a controlled manner allows for high-throughput screening of potential inhibitors or activators, facilitating the development of targeted treatments. Overall, the investigation of JAG2 recombinant proteins is essential for delineating the complexities of the Notch signaling pathway and its implications in health and disease.
