Analytical Data
-
Gene name
SOS2
- Application
-
Alternative Names
Son of sevenless homolog 2. SOS-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07890
-
Expression Region
1-312-420 aa
-
AA Sequence
LMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDRECLNQAITALMNHQGSMDRIYKQYSPRRRPGDPVCPFYSHQLRSKHLAIKKM
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SOS2 protein, a key component in the signaling pathways of plants, particularly in the context of salt stress response, has been the focus of extensive research due to its role in regulating ion homeostasis and enhancing plant tolerance to saline environments. The SOS (Salt Overly Sensitive) pathway, initially identified in Arabidopsis thaliana, is crucial for maintaining cellular ion balance under high salt conditions. Recent studies on SOS2, a serine/threonine protein kinase, have revealed its involvement in the activation of downstream effector proteins that facilitate sodium ion extrusion and potassium ion uptake. This research is driven by the increasing challenges of soil salinization and its adverse effects on agricultural productivity. Understanding the molecular mechanisms of SOS2 function can provide valuable insights into developing crop varieties with improved salt tolerance, which is essential for ensuring food security in arid and semi-arid regions. Furthermore, SOS2’s interactions with other components of the signaling network, such as SOS1 and SOS3, underline the complexity of stress responses and the potential for biotechnological applications in enhancing crop resilience to environmental stresses.
