Analytical Data
-
Gene name
JKAMP
- Application
-
Alternative Names
JKAMP;C14orf100;JAMP;JNK1/MAPK8-associated membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P055
-
Expression Region
1-311aa
-
AA Sequence
MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JKAMP is a recombinant protein that has garnered significant attention in recent years due to its potential applications in various fields such as biotechnology, pharmaceuticals, and molecular biology. The research surrounding JKAMP primarily focuses on its role as a molecular tool for studying protein interactions, cellular processes, and signal transduction pathways. It is often utilized as a model protein to investigate the mechanisms of action of different biological compounds and to enhance the efficiency of protein expression and purification techniques. Furthermore, JKAMP's unique ability to facilitate the study of protein folding and stability has made it an invaluable asset in drug development and therapeutic research. Overall, the ongoing exploration of JKAMP's characteristics and functionalities aims to expand our understanding of complex biological systems and to pave the way for innovative solutions in medical science and bioengineering.











