Analytical Data
-
Gene name
KLF1
- Application
-
Alternative Names
KLF1;EKLF;Krueppel-like factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13351
-
Expression Region
1-362aa
-
AA Sequence
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL
-
Molecular Weight
52.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLF1 (Krüppel-like factor 1), also known as EKLF (erythroid Krüppel-like factor), is a transcription factor predominantly expressed in erythroid lineages, playing a crucial role in the regulation of erythropoiesis. It is involved in the activation of globin genes and the development of red blood cells by maintaining the balance between cell proliferation and differentiation. Dysregulation of KLF1 expression has been associated with various hematological disorders, including congenital anemias and other blood-related pathologies. The study of KLF1 recombinant proteins has emerged as a significant area of interest in molecular biology and biotechnology, as these proteins can be used to elucidate the mechanisms of gene regulation in erythropoiesis and to explore potential therapeutic applications. By employing recombinant DNA technology, researchers can produce KLF1 in a controlled environment, enabling the investigation of its functional properties, interaction with other proteins, and influence on gene expression. Additionally, understanding the structural and functional characteristics of KLF1 may facilitate the development of novel strategies for treating anemic conditions and other disorders linked to erythropoiesis. As research progresses, the insights gained from KLF1 recombinant protein studies could pave the way for innovative therapeutic interventions and deepen our understanding of erythroid biology.











