Analytical Data
-
Gene name
SOCS6
- Application
-
Alternative Names
SOCS-6;Cytokine-inducible SH2 protein 4;CIS-4;Suppressor of cytokine signaling 4;SOCS-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
SOCS6
-
Expression Region
1-535 aa
-
AA Sequence
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
-
Molecular Weight
65.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SOCS6 (Suppressor of Cytokine Signaling 6) is a member of the SOCS family of proteins, which are critical negative regulators of cytokine signaling pathways. These proteins play a significant role in modulating immune responses and cellular processes by inhibiting the signal transducer and activator of transcription (STAT) pathway, among others. Research into SOCS6 has gained momentum due to its involvement in various physiological and pathological conditions, including inflammatory responses, hematopoiesis, and cancer progression. Increasing evidence suggests that SOCS6 may contribute to the regulation of key signaling pathways, such as the insulin signaling pathway and those associated with cell proliferation and differentiation. Additionally, aberrant expression of SOCS6 has been linked to tumorigenesis, highlighting its potential as a therapeutic target in oncology. To better understand its functional mechanisms and interactions within the signaling networks, the recombinant expression of SOCS6 has become a crucial research focus. By producing SOCS6 in a controlled laboratory setting, scientists can investigate its structure, post-translational modifications, and binding affinities with other proteins, which can elucidate the role SOCS6 plays in cellular signaling. Furthermore, the ability to manipulate SOCS6 levels in vitro allows researchers to explore its potential as a biomarker for disease progression and response to therapies. Overall, SOCS6 stands out as a key player in cytokine signaling regulation, and the ongoing studies on its recombinant protein present promising avenues for both fundamental research and clinical applications.
