Analytical Data
-
Gene name
ASB6
- Application
-
Alternative Names
ASB6;Ankyrin repeat and SOCS box Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NWX5
-
Expression Region
1-197aa
-
AA Sequence
MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
-
Molecular Weight
38.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASB6 (Ankyrin repeat and SOCS box-containing protein 6) is a member of the ASB family of proteins, which play crucial roles in various cellular processes, including the regulation of protein degradation and signaling pathways. The study of ASB6 is particularly relevant due to its involvement in cellular differentiation, immune response modulation, and its potential links to various diseases, including cancer and autoimmune disorders. Research has indicated that ASB6 acts as an E3 ubiquitin ligase, which is essential for tagging proteins for proteasomal degradation, thus influencing cellular homeostasis and stress response mechanisms. Understanding the functional implications of ASB6 at the molecular level can provide insights into its role in pathological conditions and its potential as a therapeutic target. Furthermore, the exploration of ASB6's structure, interactions, and regulatory mechanisms through recombinant protein techniques could reveal new aspects of gene regulation and protein interactions within the cell, paving the way for innovative approaches in disease treatment and biotechnology applications. As research progresses, the characterization and manipulation of ASB6 may lead to significant advancements in targeted therapies and improved understanding of cellular dynamics.











