Cat: PA1000-7826

Recombinant Human KLF15 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KLF15

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KLF15;KKLF;Krueppel-like factor 15

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UIH9

  • Expression Region

    1-416aa

  • AA Sequence

    MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPC SCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASS GPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEE NMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGAS AGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQ LLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKP FACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHI KVHRFPRSSRSVRSVN

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KLF15, or Krüppel-like factor 15, is a pivotal transcription factor belonging to the KLF family, known for its significant role in regulating various biological processes, including cell differentiation, proliferation, and metabolism. Research has shown that KLF15 is particularly important in cardiovascular health, glucose homeostasis, and lipid metabolism, making it a key player in diseases such as diabetes and heart failure. Furthermore, KLF15 is implicated in the regulation of gene expression in response to hormonal signals, such as insulin, which is crucial for maintaining metabolic stability. Despite its importance, the mechanisms underlying KLF15's function and its potential therapeutic applications remain inadequately explored. The production and study of recombinant KLF15 protein can provide critical insights into its structure-function relationships and regulatory pathways. By generating this protein in a controlled laboratory setting, researchers can investigate KLF15's interactions with other molecular partners and assess its effects on gene expression in various cell types. Additionally, understanding the post-translational modifications of KLF15 through recombinant methodologies may enhance our knowledge of its biological roles in health and disease. Overall, the study of recombinant KLF15 is expected to advance our understanding of its involvement in metabolic processes and identify potential targets for therapeutic intervention in metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US