Analytical Data
-
Gene name
DDX31
- Application
-
Alternative Names
DDX31Probable ATP-dependent RNA helicase DDX31; EC 3.6.4.13; DEAD box protein 31; Helicain
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H8H2
-
Expression Region
1-585aa
-
AA Sequence
MAPDLASQRHSESFPSVNSRPNVILPGREGRREGLPPGGGTRGSLVPTRPVPPSPAPLGTSPYSWSRSGPGRGGGAGSSRVPRGVPGPAVCAPGSLLHHASPTQTMAAADGSLFDNPRTFSRRPPAQASRQAKATKRKYQASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTSDRNQEERQCIKTSSLFKNNPDIPELHRPVVKQVQEKVFTSAAFHELGLHPHLISTINTVLKMSSMTSVQKQSIPVLLEGRDALVRSQTGSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKARLRKGINILISTPGRLVDHIKSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADISLHDPVSISVLDKSHDQLNPKDKAVQEVCPPPAGDKLDSFAIPESLKQHVTVVPSKLRLVCLAAFILQKCKFEEDQKMVVFFSSCELVEFHYSLFLQTLLSSSGAPASGQLPSASMRLKFLRLHGGMEQEERTAVFQEFSHSRRGVLLCT
-
Molecular Weight
90.75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX31 is a member of the DEAD-box helicase family, which is known for its potential roles in RNA metabolism, including RNA unwinding, splicing, and ribosome assembly. Recent studies have highlighted DDX31's involvement in various cellular processes, particularly in the context of cellular stress and immune response. Mutations in the DDX31 gene have been linked to immunodeficiencies and other health conditions, underscoring its importance in maintaining cellular homeostasis and function. The recombinant protein form of DDX31 serves as a valuable tool for researchers to dissect the molecular mechanisms of its action and interaction with other macromolecules. By studying DDX31 in its recombinant form, scientists aim to uncover its enzymatic properties, binding affinities, and roles in different RNA-related pathways. This research not only contributes to a better understanding of basic cellular functions but also holds potential implications for therapeutic development in diseases associated with DDX31 dysfunction. As such, the investigation of DDX31 recombinant protein offers promising avenues for enhancing our comprehension of RNA biology and its impact on human health.
