Analytical Data
-
Gene name
MTFP1
- Application
-
Alternative Names
MTFP1；MTP18；Mitochondrial fission process Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UDX5
-
Expression Region
1-166aa
-
AA Sequence
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
-
Molecular Weight
45.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTFP1, or mitochondrial fission protein 1, plays a critical role in the dynamics of mitochondrial morphology and function, which are essential for maintaining cellular health and energy metabolism. Research has shown that MTFP1 is involved in the regulation of mitochondrial fission, a process vital for mitochondrial quality control, distribution, and apoptosis. Dysregulation of mitochondrial dynamics is associated with various pathological conditions, including neurodegenerative diseases, metabolic disorders, and cancer. The study of MTFP1 and its recombinant protein has garnered attention as it offers insights into these disease mechanisms and potential therapeutic targets. By understanding how MTFP1 operates at a molecular level, researchers aim to elucidate the pathways that govern mitochondrial behavior and to explore its implications in cellular signaling and survival. Furthermore, recombinant MTFP1 protein serves as a valuable tool for studying protein interactions and functional assays, thereby contributing to the broader understanding of mitochondrial biology and its impact on human health.
