Analytical Data
-
Gene name
SNX12
- Application
-
Alternative Names
SNX12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UMY4
-
Expression Region
2-172 aa
-
AA Sequence
SDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA
-
Molecular Weight
24.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNX12, a member of the sorting nexin family, plays a crucial role in intracellular trafficking and membrane dynamics. Research on SNX12 has garnered attention due to its involvement in various cellular processes, including endosomal sorting and vesicular transport, which are essential for maintaining cellular homeostasis. It has been implicated in the regulation of receptor recycling and degradation, impacting signaling pathways related to growth and differentiation. Understanding the functional mechanisms of SNX12 is also significant in the context of disease, as dysregulation of trafficking pathways can lead to conditions such as cancer and neurodegenerative disorders. By studying the recombinant SNX12 protein, researchers aim to elucidate its structural properties and interactions with other cellular partners, which may provide insights into the underlying mechanisms of diseases associated with cellular transport dysfunction. The production of recombinant SNX12 protein allows for detailed biochemical and biophysical characterizations, facilitating the exploration of its role in endosomal pathways and potential therapeutic applications. This research could contribute to the development of novel strategies targeting SNX12-related pathways in various diseases, highlighting its importance in both basic and applied biomedical research.
