Analytical Data
-
Gene name
MRPL20
- Application
-
Alternative Names
MRPL20；Large ribosomal subunit Protein bL20m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYC9
-
Expression Region
46-149aa
-
AA Sequence
VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
-
Molecular Weight
27.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL20, a mitochondrial ribosomal protein, is a key component of the mitochondrial ribosome, where it plays a crucial role in synthesizing mitochondrial proteins. Given that mitochondria are essential for ATP production and play a significant role in various metabolic pathways, understanding the function of MRPL20 is vital for elucidating mitochondrial biology and its implications in human health. Recent studies have linked mitochondrial dysfunction to a range of diseases, including neurodegenerative disorders, metabolic syndromes, and certain types of cancer. Consequently, MRPL20 has garnered attention not only for its fundamental biological role but also for its potential involvement in these disease processes. Research has focused on the molecular mechanisms by which MRPL20 contributes to mitochondrial protein synthesis and the implications of its dysregulation in pathology. Furthermore, the exploration of MRPL20 as a biomarker or therapeutic target is an emerging area of interest, particularly in the context of mitochondrial-related diseases. Overall, studying MRPL20 provides valuable insights into mitochondrial function and its broader impact on health and disease.
