Analytical Data
-
Gene name
SYNGAP1
- Application
-
Alternative Names
SYNGAP1；KIAA1938；Ras/Rap GTPase-activating Protein SynGAP
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PV0
-
Expression Region
1161-1343aa
-
AA Sequence
MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
-
Molecular Weight
25.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYNGAP1 is a gene located on chromosome 6 that encodes a protein involved in synaptic signaling and plasticity, crucial for cognitive functions such as learning and memory. Mutations in SYNGAP1 are associated with a range of neurodevelopmental disorders, including intellectual disability, autism spectrum disorders, and epilepsy. Research has increasingly focused on SYNGAP1 due to its role in various forms of synaptic dysfunction, which are prevalent in these disorders. The study of SYNGAP1 recombinant proteins is essential for understanding the molecular mechanisms underlying these conditions, as well as for the development of targeted therapies. By producing and characterizing SYNGAP1 recombinant proteins, researchers aim to investigate how alterations in SYNGAP1 function contribute to synaptic abnormalities. This investigation may reveal potential biomarkers for diagnosing related neurodevelopmental disorders and provide insights into therapeutic strategies to enhance synaptic function and improve cognitive outcomes. As the field progresses, understanding the pathways and interactions influenced by SYNGAP1 will be pivotal in addressing the challenges posed by SYNGAP1-related conditions, ultimately aiming to translate findings into clinical applications that enhance the quality of life for affected individuals.
