Cat: PA1000-7769

Recombinant Human GLI1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLI1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLI1;GLI;Zinc finger Protein GLI1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08151

  • Expression Region

    401-500aa

  • AA Sequence

    GPLPRAPSISTVEPKREREGGPIREESRLTVPEGAMKPQPSPGAQSSCSS DHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLRRLEN

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLI1, a key transcription factor in the Hedgehog signaling pathway, plays a critical role in embryonic development and tissue homeostasis. Abnormal regulation of GLI1 is implicated in various human diseases, particularly cancer, where it is often overexpressed, leading to unchecked cellular proliferation and survival. Understanding GLI1's function has significant therapeutic implications, especially in targeting Hedgehog pathway-related malignancies. Researchers have been increasingly focused on characterizing GLI1’s structure and function through recombinant protein studies. By utilizing techniques such as cloning, expression, and purification of GLI1, scientists aim to elucidate its mechanisms of action, interactions with other proteins, and the impact of post-translational modifications. These studies contribute to a deeper understanding of the molecular underpinnings of diseases associated with GLI1 dysregulation and pave the way for developing potential interventions, including small molecule inhibitors or gene therapies. Furthermore, recombinant GLI1 proteins serve as valuable tools in drug discovery, allowing for the screening of compounds that can modulate its activity. Overall, the research on recombinant GLI1 is essential for advancing our knowledge of cellular signaling pathways and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US