Analytical Data
-
Gene name
DAD1
- Application
-
Alternative Names
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61803
-
Expression Region
1-113aa
-
AA Sequence
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
-
Molecular Weight
38.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAD1 (Defender Against Death 1) is a crucial protein identified in several organisms that plays a significant role in cell survival and stress response. Initially discovered in plants, DAD1 has drawn attention for its protective functions against programmed cell death and its involvement in resistance to various environmental stresses. Research shows that DAD1 acts as a chaperone, assisting in the proper folding of proteins and protecting cells from apoptosis induced by harmful stimuli such as pathogens or extreme environmental conditions. The study of DAD1's structure and function is significant in understanding cellular mechanisms of survival, particularly in stress responses. Recent advancements in recombinant DNA technology have allowed for the expression and purification of DAD1 as a recombinant protein, enabling detailed functional studies. This research offers insights into potential applications in biotechnology and agriculture, such as developing stress-resistant crops or elucidating pathways for enhancing cell survival in medical fields. The growing interest in DAD1 underscores its importance as a model protein for cellular stress responses and highlights the potential for future investigations to uncover novel therapeutic targets or strategies to enhance resilience in both plant and animal systems.
