Analytical Data
-
Gene name
DAF
- Application
-
Alternative Names
CD 55; CD55; CD55 antigen; CD55 Cromer blood group system; CD55 molecule (Cromer blood group); CD55 molecule; CD55 molecule; decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay accelerating factor; Complement decay-accelerating factor; Complement decay-accelerating factor; GPI-anchored; CR; CROM; Cromer Blood Group antigen; Cromer blood group system; DAF; Daf-GPI; DAF_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08174
-
Expression Region
35-353aa
-
AA Sequence
ADPDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSHHHHHH.
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAF (decay-accelerating factor) is an important regulatory protein that plays a crucial role in the immune system by inhibiting the complement cascade, thereby preventing the lysis of host cells. Understanding the structure and function of DAF has significant implications for therapeutic strategies in various diseases, including autoimmune disorders and transplantation. Research on DAF has evolved over the years, revealing its dual role as a regulatory factor and a signaling molecule. Moreover, aberrations in DAF expression or function have been linked to several pathological conditions, highlighting the need for detailed investigations into its mechanism of action. Recent studies have focused on the molecular dynamics and conformational changes of DAF under different physiological conditions, aiming to elucidate how these variations affect its protective functions. Additionally, the use of recombinant DAF proteins in laboratory settings has paved the way for exploring novel treatments that can enhance its protective roles or mimic its function in complement-mediated diseases. Overall, the ongoing research into DAF not only contributes to our understanding of immune regulation but also opens up new avenues for developing targeted therapies to modulate complement activity in various clinical contexts.
