Analytical Data
-
Gene name
CYP4F22
- Application
-
Alternative Names
CYP4F22Cytochrome P450 4F22; EC 1.14.14.-
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NT55
-
Expression Region
1-531aa
-
AA Sequence
MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA
-
Molecular Weight
88.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP4F22 is a member of the cytochrome P450 family of enzymes, which play a critical role in the metabolism of various endogenous and exogenous compounds. Research on CYP4F22 has gained prominence due to its involvement in the biotransformation of fatty acids, particularly in the skin, and its possible implication in the pathogenesis of skin conditions like atopic dermatitis and psoriasis. Notably, mutations in the CYP4F22 gene have been linked to the development of lamellar ichthyosis, a severe skin disorder characterized by abnormal skin barrier function. Understanding the enzymatic activity and substrate specificity of CYP4F22 through the study of its recombinant protein could provide insights into its physiological roles and potential therapeutic targets. Moreover, the production and characterization of CYP4F22 recombinant protein enable researchers to investigate its function in drug metabolism and toxicology, leading to a better understanding of its contributions to skin health and disease. Given the significant roles that cytochrome P450 enzymes play in pharmacokinetics, studies focusing on CYP4F22 are essential not only for unraveling the biochemical pathways linked to skin disorders but also for informing clinical approaches in dermatology and personalized medicine.
