Analytical Data
-
Gene name
ADAMTS18
- Application
-
Alternative Names
ADAMTS18；ADAMTS21；A disintegrin and metalloProteinase with thrombospondin motifs 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TE60
-
Expression Region
712-970aa
-
AA Sequence
NDVCIDGVCELVGCDHELGSKAVSDACGVCKGDNSTCKFYKGLYLNQHKANEYYPVVLIPAGARSIEIQELQVSSSYLAVRSLSQKYYLTGGWSIDWPGEFPFAGTTFEYQRSFNRPERLYAPGPTNETLVFEILMQGKNPGIAWKYALPKVMNGTPPATKRPAYTWSIVQSECSVSCGGGYINVKAICLRDQNTQVNSSFCSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAV
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADAMTS18 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 18) is a member of the ADAMTS family of proteins, which play crucial roles in extracellular matrix (ECM) remodeling and cellular signaling. Its research background is particularly significant due to its implications in various physiological and pathological processes, including tissue development, repair, and disease. Studies have suggested that ADAMTS18 may be involved in cancer progression, as well as in disorders related to cartilage and connective tissue, highlighting its potential role as a biomarker or therapeutic target. Additionally, the unique structure of ADAMTS18, featuring multiple thrombospondin motifs, indicates its potential influence on cell adhesion and migration. Recombinant expressions of ADAMTS18 are crucial for elucidating its functional properties, interactions with other matrix components, and regulatory mechanisms. Understanding its biological functions could advance our knowledge of ECM dynamics and lead to the development of novel strategies for treating diseases associated with ECM dysregulation, making ADAMTS18 a valuable focus of ongoing biochemical and biomedical research.
