Analytical Data
-
Gene name
CYP4A11
- Application
-
Alternative Names
Cytochrome P450 4A11. EC:1.14.14.1. 20-hydroxyeicosatetraenoic acid synthase. 20-HETE synthase. CYP4AII. CYPIVA11. Cytochrome P-450HK-omega. Cytochrome P450HL-omega. Fatty acid omega-hydroxylase. Lauric acid omega-hydroxylase. Long-chain fatty acid omega-monooxygenase. EC:1.14.14.80
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02928
-
Expression Region
1-215aa
-
AA Sequence
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
-
Molecular Weight
49.39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP4A11 is a member of the cytochrome P450 family, which plays a crucial role in the metabolism of various endogenous and exogenous compounds, including fatty acids, drugs, and toxins. This enzyme is primarily expressed in the liver and is involved in the metabolism of arachidonic acid, influencing the production of important signaling molecules known as eicosanoids. Research has indicated that variations in the CYP4A11 gene can impact an individual's response to medications and susceptibility to certain diseases, such as hypertension and kidney disorders. Understanding the function and regulation of CYP4A11 is essential for elucidating its role in drug metabolism and disease pathogenesis. Recent advances in molecular biology techniques have enabled the production of recombinant CYP4A11 proteins, facilitating detailed studies of their biochemical properties and interactions with various substrates. This research is critical for developing personalized medicine approaches, which account for genetic variations in drug metabolism, ultimately improving therapeutic outcomes in patients. By investigating CYP4A11's enzymatic activities and regulatory mechanisms, scientists aim to uncover potential targets for pharmacological intervention and to enhance our understanding of metabolic pathways influenced by this important enzyme.
