Analytical Data
-
Gene name
DAND5
- Application
-
Alternative Names
DAND5；CER2；CKTSF1B3；GREM3；DAN domain family member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N907
-
Expression Region
23-189aa
-
AA Sequence
RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
-
Molecular Weight
34.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAND5, a member of the DAN family of extracellular matrix proteins, has garnered significant attention in developmental biology due to its role as a negative regulator of the bone morphogenetic protein (BMP) signaling pathway. Research has shown that DAND5 is involved in various physiological processes, including embryonic development, organogenesis, and cellular differentiation. Its expression is particularly prominent during early developmental stages, suggesting that it plays a crucial role in the establishment of body plan and organ formation. Dysregulation of DAND5 expression has been linked to various pathological conditions, including cancer, making it a relevant target for therapeutic strategies. The mechanism by which DAND5 modulates BMP signaling is of particular interest, as it can potentially impact cell fate decisions and tissue homeostasis. Recent studies have focused on the characterization of DAND5's structure and function, aiming to elucidate its precise role in signaling pathways and potential interactions with other molecular players. This research is essential for understanding not only the fundamental aspects of developmental biology but also the implications of DAND5 in disease contexts. Overall, DAND5 represents a promising area of study for both basic and applied biomedical research, highlighting its significance in developmental processes and its potential as a therapeutic target.
