Cat: PA1000-7747

Recombinant Human ROS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ROS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ROS1;MCF3;ROS;Proto-oncogene tyrosine-Protein kinase ROS

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08922

  • Expression Region

    1881-2347aa

  • AA Sequence

    VWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACYAIHTLPT QEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVK TLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELME GRDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDL AARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAP ESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRL EPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKSR DEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNYMVLATE CGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPE GLNYACLTHSGYGDGSD

  • Molecular Weight

    82 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Research on recombinant ROS1 (Receptor of Activated C Kinase 1) proteins has gained prominence due to their critical roles in various biological processes and disease pathways, particularly in cancer. ROS1 is a receptor tyrosine kinase that, when rearranged or mutated, has been implicated in the pathogenesis of several tumors, notably non-small cell lung cancer (NSCLC). Understanding the structural and functional characteristics of ROS1 is crucial for the development of targeted therapies. With advancements in recombinant DNA technology, scientists can produce large quantities of pure ROS1 proteins, enabling detailed studies of their signaling mechanisms and interactions with other cellular proteins. This research facilitates the exploration of novel therapeutic strategies, including small-molecule inhibitors and monoclonal antibodies against aberrant ROS1 pathways. Additionally, studying recombinant ROS1 aids in the comprehension of its normal biological functions in cell proliferation and differentiation, thereby providing insights into potential clinical applications. The therapeutic potential of targeting ROS1 in oncology underscores the necessity for continued investigation into recombinant forms of the protein, as they hold promise for improving patient outcomes in ROS1-positive malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US