Analytical Data
-
Gene name
BTN2A2
- Application
-
Alternative Names
BTN2A2；BT2.2；BTF2；Butyrophilin subfamily 2 member A2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVV5
-
Expression Region
33-262aa
-
AA Sequence
QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTN2A2 (Butyrophilin subfamily 2 member A2) is a protein that belongs to the butyrophilin family, which plays a critical role in modulating immune responses, particularly in T cell-mediated immunity. This protein has garnered attention due to its potential implications in various health conditions, including autoimmune diseases and cancers. Research has shown that BTN2A2 may interact with receptors on immune cells, influencing their activation and function, thus affecting the overall immune landscape. Studies have explored its expression patterns in different tissues and conditions, revealing a correlation between BTN2A2 expression and disease states. Additionally, BTN2A2 presents an interesting target for immunotherapy, as modulating its activity could enhance antitumor responses or regulate autoimmunity. The generation of recombinant BTN2A2 protein serves as a valuable tool for in-depth biochemical studies and the development of potential therapeutic applications. Understanding the structure-function relationship of BTN2A2 can provide insights into its role in immune regulation and open avenues for innovative treatment strategies in diseases where immune modulation is essential. As such, ongoing research into BTN2A2 and its recombinant forms is critical for uncovering its biological significance and therapeutic potential in immune-related diseases.
