Analytical Data
-
Gene name
CYLC2
- Application
-
Alternative Names
CYLC2; CYL2Cylicin-2; Cylicin II; Multiple-band polypeptide II
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14093
-
Expression Region
1-348aa
-
AA Sequence
MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK
-
Molecular Weight
64.68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYLC2 is a recombinant protein that has attracted significant attention in the field of molecular biology and biochemistry due to its potential applications in therapeutics and diagnostics. It is derived from the cyclin family of proteins, which play critical roles in the regulation of the cell cycle, thereby influencing cell proliferation, differentiation, and apoptosis. Recent studies have suggested that CYLC2 may have important functions in various cellular processes, including tumorigenesis and cellular responses to stress. Given the increasing prevalence of cancer and other diseases linked to cell cycle dysregulation, understanding the structure and function of CYLC2 could provide insights into novel treatment strategies. Researchers are focusing on elucidating the mechanisms through which CYLC2 interacts with other cellular proteins and pathways, as well as its potential as a biomarker for cancer diagnosis and prognosis. By employing techniques such as recombinant DNA technology, protein purification, and functional assays, scientists aim to characterize CYLC2 comprehensively. This research provides a foundation for further exploration of CYLC2 in therapeutic contexts, potentially leading to the development of targeted interventions that can modulate its activity in diseased states. As such, the study of CYLC2 not only enhances our understanding of cell cycle regulation but also opens new avenues for innovative biomedical applications.
