Cat: PA2000-3320

Recombinant E.coli MSRB7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MSRB7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MSRB7;Peptide methionine sulfoxide reductase B7

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8VY86

  • Expression Region

    1-144aa

  • AA Sequence

    MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ

  • Molecular Weight

    31.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MSRB7 (Methionine Sulfoxide Reductase B7) is a member of the methionine sulfoxide reductase family, which plays a crucial role in the cellular response to oxidative stress by repairing oxidized methionine residues in proteins. This process is vital for maintaining the structural and functional integrity of proteins under oxidative conditions. Research has indicated that MSRB7 is involved in various physiological processes, including cellular signaling, apoptosis, and the regulation of protein function. Its expression has been linked to several diseases, including neurodegenerative disorders and cancer, where oxidative stress is a contributing factor. The study of MSRB7's structure and function has revealed insights into its enzymatic mechanism and interactions with other redox-active proteins. Moreover, understanding the role of MSRB7 in cellular redox homeostasis can provide potential therapeutic targets for conditions characterized by oxidative damage. The investigation of MSRB7 reorganization has gained interest, particularly in the context of developing antioxidant strategies aimed at minimizing cellular damage and improving overall cellular health. By elucidating the molecular mechanisms of MSRB7, researchers aim to harness its protective capabilities against oxidative stress and explore its applications in biotechnology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US