Analytical Data
-
Gene name
MSRB7
- Application
-
Alternative Names
MSRB7；Peptide methionine sulfoxide reductase B7
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8VY86
-
Expression Region
1-144aa
-
AA Sequence
MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ
-
Molecular Weight
31.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSRB7 (Methionine Sulfoxide Reductase B7) is a member of the methionine sulfoxide reductase family, which plays a crucial role in the cellular response to oxidative stress by repairing oxidized methionine residues in proteins. This process is vital for maintaining the structural and functional integrity of proteins under oxidative conditions. Research has indicated that MSRB7 is involved in various physiological processes, including cellular signaling, apoptosis, and the regulation of protein function. Its expression has been linked to several diseases, including neurodegenerative disorders and cancer, where oxidative stress is a contributing factor. The study of MSRB7's structure and function has revealed insights into its enzymatic mechanism and interactions with other redox-active proteins. Moreover, understanding the role of MSRB7 in cellular redox homeostasis can provide potential therapeutic targets for conditions characterized by oxidative damage. The investigation of MSRB7 reorganization has gained interest, particularly in the context of developing antioxidant strategies aimed at minimizing cellular damage and improving overall cellular health. By elucidating the molecular mechanisms of MSRB7, researchers aim to harness its protective capabilities against oxidative stress and explore its applications in biotechnology and medicine.
