Analytical Data
-
Gene name
PIGX
- Application
-
Alternative Names
PIGX；Phosphatidylinositol-glycan biosynthesis class X Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBF5
-
Expression Region
42-230aa
-
AA Sequence
MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSL
-
Molecular Weight
37.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIGX, a crucial component in the glycosylphosphatidylinositol (GPI) anchor biosynthetic pathway, plays a significant role in the post-translational modification of proteins, which is essential for their anchoring to the cell membrane. GPI anchors are vital for the proper functioning of various proteins, including enzymes and receptors, influencing numerous cellular processes such as signal transduction, cell adhesion, and immune response. The research surrounding PIGX recombinant proteins stems from the need to better understand its function and regulation, particularly in the context of human diseases, such as cancer and neurodegenerative disorders, where GPI-anchored proteins are often implicated. Investigating PIGX and its interactions with other biosynthetic enzymes not only enhances our knowledge of GPI anchor synthesis but also opens avenues for novel therapeutic strategies by potentially targeting these pathways. Thus, studying PIGX recombinant proteins serves both fundamental scientific interests and practical biomedical applications, aiming to elucidate the molecular mechanisms behind GPI anchoring and its impact on health and disease.
