Analytical Data
-
Gene name
CYBRD1
- Application
-
Alternative Names
CYBRD1; DCYTB; FRRS3; Plasma membrane ascorbate-dependent reductase CYBRD1; Cytochrome b reductase 1; Duodenal cytochrome b; Ferric-chelate reductase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53TN4
-
Expression Region
1-286aa
-
AA Sequence
MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIAIIVYRLPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLSGFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
-
Molecular Weight
31.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYBRD1 (Cytochrome b reductase 1) is a crucial membrane-bound protein embedded in the endoplasmic reticulum, primarily known for its role in the reduction of cytochrome b5 and its involvement in various metabolic processes, including lipid synthesis and drug metabolism. Research has indicated that CYBRD1 plays a significant role in cellular oxidative stress responses, linking it to various pathophysiological conditions, including cancer and cardiovascular diseases. Additionally, CYBRD1 has been implicated in the regulation of iron homeostasis, suggesting its importance in conditions like anemia and other iron-related disorders. As a result, the recombinant expression and purification of CYBRD1 for structural and functional studies have garnered considerable interest within the scientific community. By elucidating its molecular mechanisms and interactions, researchers aim to uncover potential therapeutic targets and strategies for diseases associated with dysregulated CYBRD1 activity. Moreover, understanding the structure-function relationship of CYBRD1 could pave the way for the development of novel biotech applications in medicine and industry, highlighting the necessity for comprehensive studies on this intriguing protein.











