Analytical Data
-
Gene name
DNASE1L3
- Application
-
Alternative Names
DNASE1L3;DHP2;DNAS1L3;Deoxyribonuclease gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13609
-
Expression Region
21-305aa
-
AA Sequence
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPI LMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYH DYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVE VYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQ EDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALD VSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNASE1L3, a member of the DNase I family, has gained significant attention in recent years due to its crucial role in extracellular DNA degradation and its potential implications in various biological processes and diseases. This enzyme is predominantly expressed in tissues such as the pancreas, lung, and spleen, where it participates in clearing excess DNA from the extracellular environment, thus preventing detrimental inflammatory responses. The dysfunction of DNASE1L3 has been linked to several pathological conditions, including autoimmune diseases and chronic inflammatory disorders, highlighting its importance in maintaining cellular homeostasis and immune regulation. The recombinant expression of DNASE1L3 allows researchers to study its enzymatic properties, structure-function relationship, and therapeutic potential in greater detail. Understanding the biochemical and biophysical characteristics of DNASE1L3 could pave the way for the development of novel therapeutic strategies aimed at modulating extracellular DNA levels, enhancing the immune response, or even treating diseases associated with dysregulated DNA clearance. The use of recombinant protein also facilitates the exploration of DNASE1L3's interactions with other biomolecules, potentially shedding light on its role in disease processes and offering insights into novel diagnostic and therapeutic applications. Overall, ongoing research into DNASE1L3 holds promise for addressing significant medical challenges and advancing our comprehension of fundamental biological mechanisms.











