Analytical Data
-
Gene name
CSNK1A1L
- Application
-
Alternative Names
CSNK1A1L；Casein kinase I isoform alpha-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N752
-
Expression Region
1-337aa
-
AA Sequence
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQ KVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDL FNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHC NKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSR RDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCK GFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
-
Molecular Weight
64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSNK1A1L, or Casein Kinase 1 Alpha 1-Like, is a member of the casein kinase 1 (CK1) family of serine/threonine kinases, which play critical roles in various cellular processes, including cell signaling, circadian rhythms, and cell cycle regulation. The study of CSNK1A1L is significant due to its involvement in key biological pathways and its potential implications in various diseases, particularly cancer and neurological disorders. The kinase activity of CSNK1A1L is essential for the phosphorylation of downstream substrates, influencing signaling cascades that mediate cellular responses to environmental stimuli. Recent research has highlighted its role in modulating pathways related to Wnt signaling, which is crucial for embryonic development and tissue homeostasis. Additionally, abnormal regulation of CSNK1A1L has been linked to pathological conditions, making it a promising target for therapeutic intervention. The generation of recombinant CSNK1A1L protein is vital for functional studies, enabling researchers to investigate its enzymatic properties, substrate specificity, and interaction with other proteins. This understanding could pave the way for the development of novel treatments that target CK1 family kinases, enhancing our ability to manipulate these pathways in disease contexts. Overall, ongoing research into CSNK1A1L aims to elucidate its biological significance and therapeutic potential, fostering advancements in cancer treatment and the management of neurodegenerative disorders.
