Analytical Data
-
Gene name
SLC35F1
- Application
-
Alternative Names
SLC35F1; C6orf169; Solute carrier family 35 member F1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T1Q4
-
Expression Region
1-408 aa
-
AA Sequence
MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQRIRKVLNREMLISVALGQVLSLLICGIGLTSKYLSEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTNLTSIQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLGGATLYGISNVWEEYIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSACMFGLYSFMQVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGLVLYSSTSTYIAQDPRVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA
-
Molecular Weight
71.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35F1, a member of the solute carrier family, has garnered attention in recent biological and medical research due to its potential role in cellular transport processes. This protein is primarily implicated in nucleotide-sugar transport across the cell membrane, a function that is crucial for glycoconjugate biosynthesis and cell signaling. Abnormal expression or dysfunction of SLC35F1 has been linked to various diseases, including certain cancers and metabolic disorders, making it a target of interest for therapeutic interventions. Recent studies have focused on the recombinant expression of SLC35F1 to better understand its structural and functional characteristics, as well as its interactions with other cellular components. By producing recombinant SLC35F1 in model systems, researchers aim to elucidate its mechanisms of action and regulatory pathways, which may pave the way for novel strategies in treating conditions influenced by glycosylation defects. The insights gained from studying SLC35F1 not only enhance our understanding of fundamental biological processes but also resonate with potential clinical applications, highlighting the importance of this transporter in health and disease.
