Analytical Data
-
Gene name
FMR1NB
- Application
-
Alternative Names
FMR1NB；FMR1 neighbor Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N0W7
-
Expression Region
90-183aa
-
AA Sequence
LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ
-
Molecular Weight
15.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FMR1NB (Fragile X Mental Retardation 1 Neighboring Gene) is a gene that has garnered attention in the realm of genetic research due to its potential role in neurodevelopmental disorders. Located adjacent to the FMR1 gene, which is famously associated with Fragile X syndrome, FMR1NB is believed to be involved in the regulation of various cellular processes and may impact neuronal function. Recent studies have suggested that FMR1NB could play a critical role in modulating synaptic plasticity, a key mechanism underlying learning and memory. The understanding of FMR1NB's function is still in its early stages, but it may also contribute to the broader spectrum of psychiatric and neurodevelopmental disorders beyond Fragile X syndrome itself. Researchers are investigating the mechanisms by which FMR1NB influences neuronal behavior, its interactions with other key proteins, and its expression patterns during brain development. The recombinant protein derived from FMR1NB is being studied for its potential applications in understanding the pathophysiology of related disorders and may lead to the identification of new therapeutic targets. As such, FMR1NB serves as a promising candidate for further exploration in the context of neurobiology, genetics, and therapeutic development. Understanding its role could provide deeper insights into the molecular underpinnings of critical neurodevelopmental processes and pave the way for interventions targeting related disorders.
