Analytical Data
-
Gene name
CUTL2
- Application
-
Alternative Names
CDP2; Cut like homeobox 2; Cut-like 2; CUTL2; Cux2; CUX2_HUMAN; Homeobox protein cut-like 2; Homeobox protein cux 2; Homeobox protein Cux-2; KIAA0293
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14529
-
Expression Region
121-220aa
-
AA Sequence
FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGK ALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CUTL2, a member of the CUT family of transcription factors, has garnered increasing attention in recent years due to its critical roles in developmental processes and cellular function. This protein is known for its involvement in regulating gene expression during embryogenesis and has been implicated in various biological pathways, including those related to cell proliferation, differentiation, and apoptosis. Emerging studies have suggested that CUTL2 may play a significant role in certain diseases, including cancer, by influencing tumor growth and metastasis. The need for detailed understanding of CUTL2’s structure and function has prompted the focus on the recombinant expression of this protein. Utilizing recombinant DNA technology allows for the production of large quantities of CUTL2, enabling researchers to investigate its biochemical properties, interaction with other molecules, and functional mechanisms in cellular contexts. Furthermore, characterizing CUTL2 as a recombinant protein facilitates the development of specific antibodies and the exploration of its potential as a therapeutic target. The insights gained from such studies may provide a deeper understanding of the molecular underpinnings of diseases associated with CUTL2 dysregulation and contribute to novel strategies for intervention and treatment.
